PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g009215m
Common NameCISIN_1g009215mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 541aa    MW: 60858 Da    PI: 5.106
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g009215mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS351.61.2e-1071635331374
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.....sseelaalklfsev 87 
                        lv+lLl+cAeav  +d++la ++L+++   a+p gd++qR+  +f+ +L++rl+   +++ +  + +  +  +      +e++ a++l +++
  orange1.1g009215m 163 LVHLLLACAEAVGCRDTKLAVSMLSQIWASATPWGDSLQRVSYCFALGLKSRLSL-LQNINANGTFTGGAM-DvplitREEKMEAFQLVYQT 252
                        68***************************************************98.555555555544443.347777899999******** PP

               GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefn 179
                        +P++ f++++aN+aI +a++g++ +HiiD++++  lQWp+L+++LasRpegpp++RiT + s++  +  el++  +   + A++lg+++ef+
  orange1.1g009215m 253 TPYISFGFMAANEAIRQAAQGKDSLHIIDLGMERTLQWPSLIRSLASRPEGPPRIRITCLISNQ--NLSELKASMKPVLHDATSLGINLEFS 342
                        **************************************************************66..889999999999999*********** PP

               GRAS 180 vlvak.rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                        ++ +  + + l+ e+L++++gEal Vn++++lh+ ++es  + +   ++L+++k+l+P++++vveq+a+hn++ Fl rfle+l+yysa+fds
  orange1.1g009215m 343 MISEPvTPSLLTRENLDLREGEALFVNSIMHLHKYVKESRGSLK---AILQAIKRLNPTLLTVVEQDANHNGPFFLGRFLESLHYYSAIFDS 431
                        *7443588999*************************88776666...9******************************************** PP

               GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                        lea+lpr+s  r+++Er  +++ei+n+va eg++r+erhe++++Wr++l++aGF+ v l++   +qa+++l+ ++ dgy++ +e+g+l+lgW
  orange1.1g009215m 432 LEASLPRNSPLRMNIERLHFAEEIRNIVAYEGSDRIERHERAHQWRRQLGRAGFQLVGLKS--LSQARMMLSVYGCDGYTLACEKGCLLLGW 521
                        **********************************************************986..89*************************** PP

               GRAS 363 kdrpLvsvSaWr 374
                        k+rp++ +SaW+
  orange1.1g009215m 522 KGRPIMLASAWQ 533
                        ***********6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098552.555137515IPR005202Transcription factor GRAS
PfamPF035144.2E-105163533IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 541 aa     Download sequence    Send to blast
METMNGWLRL PMHESFNHDL AIRRFCPARV EQEQREWEET MNELELLSPY HEDAITSTSQ  60
DLAASEVDEF VDSFINMDHE DKDDDREINK SPALADHEAE TFSMVNDGYG DQVSMMIEGN  120
DHHLETMSID FSGEDHDHHF TVVPEMVPSV EEVSHGVDQG LHLVHLLLAC AEAVGCRDTK  180
LAVSMLSQIW ASATPWGDSL QRVSYCFALG LKSRLSLLQN INANGTFTGG AMDVPLITRE  240
EKMEAFQLVY QTTPYISFGF MAANEAIRQA AQGKDSLHII DLGMERTLQW PSLIRSLASR  300
PEGPPRIRIT CLISNQNLSE LKASMKPVLH DATSLGINLE FSMISEPVTP SLLTRENLDL  360
REGEALFVNS IMHLHKYVKE SRGSLKAILQ AIKRLNPTLL TVVEQDANHN GPFFLGRFLE  420
SLHYYSAIFD SLEASLPRNS PLRMNIERLH FAEEIRNIVA YEGSDRIERH ERAHQWRRQL  480
GRAGFQLVGL KSLSQARMML SVYGCDGYTL ACEKGCLLLG WKGRPIMLAS AWQVNNASSS  540
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-481635334375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006493798.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A067F2I60.0A0A067F2I6_CITSI; Uncharacterized protein
STRINGPOPTR_0005s09790.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17612910
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.13e-81RGA-like 1